SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4wa2c1 (4wa2 C:8-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040338Species Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311449] (2 PDB entries)
  8. 2040347Domain d4wa2c1: 4wa2 C:8-324 [309808]
    Other proteins in same PDB: d4wa2a2, d4wa2b2, d4wa2c2, d4wa2d2, d4wa2e2, d4wa2f2
    automated match to d1ha0a1
    complexed with nag

Details for d4wa2c1

PDB Entry: 4wa2 (more details), 2.5 Å

PDB Description: The crystal structure of hemagglutinin from a H3N8 influenza virus isolated from New England harbor seals in complex with 3'SLN
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4wa2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa2c1 b.19.1.2 (C:8-324) Hemagglutinin {Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqstlklatgmrnvp

SCOPe Domain Coordinates for d4wa2c1:

Click to download the PDB-style file with coordinates for d4wa2c1.
(The format of our PDB-style files is described here.)

Timeline for d4wa2c1:

  • d4wa2c1 is new in SCOPe 2.06-stable