Lineage for d4wa2a2 (4wa2 A:330-503)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 2592381Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries)
  8. 2592388Domain d4wa2a2: 4wa2 A:330-503 [309805]
    Other proteins in same PDB: d4wa2a1, d4wa2b1, d4wa2c1, d4wa2d1, d4wa2e1, d4wa2f1
    automated match to d1ha0a2
    complexed with nag

Details for d4wa2a2

PDB Entry: 4wa2 (more details), 2.5 Å

PDB Description: The crystal structure of hemagglutinin from a H3N8 influenza virus isolated from New England harbor seals in complex with 3'SLN
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4wa2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa2a2 h.3.1.0 (A:330-503) automated matches {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik

SCOPe Domain Coordinates for d4wa2a2:

Click to download the PDB-style file with coordinates for d4wa2a2.
(The format of our PDB-style files is described here.)

Timeline for d4wa2a2: