Lineage for d4wa2a1 (4wa2 A:8-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775554Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311449] (2 PDB entries)
  8. 2775561Domain d4wa2a1: 4wa2 A:8-324 [309804]
    Other proteins in same PDB: d4wa2a2, d4wa2b2, d4wa2c2, d4wa2d2, d4wa2e2, d4wa2f2
    automated match to d1ha0a1
    complexed with nag

Details for d4wa2a1

PDB Entry: 4wa2 (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals in complex with 3'sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4wa2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa2a1 b.19.1.2 (A:8-324) Hemagglutinin {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqstlklatgmrnvp

SCOPe Domain Coordinates for d4wa2a1:

Click to download the PDB-style file with coordinates for d4wa2a1.
(The format of our PDB-style files is described here.)

Timeline for d4wa2a1: