Lineage for d4wa1f1 (4wa1 F:8-324)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimersFamily b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) Protein Hemagglutinin [49824] (19 species)
includes rudiment esterase domain
Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311449] (2 PDB entries) 
Domain d4wa1f1: 4wa1 F:8-324 [309802]
Other proteins in same PDB: d4wa1a2, d4wa1b2, d4wa1c2, d4wa1d2, d4wa1e2, d4wa1f2
automated match to d1ha0a1
complexed with bma, nag
Details for d4wa1f1
PDB Entry: 4wa1 (more details), 1.9 Å
PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals
PDB Compounds: (F:) HemagglutininSCOPe Domain Sequences for d4wa1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa1f1 b.19.1.2 (F:8-324) Hemagglutinin {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm
dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw
tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst
nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqstlklatgmrnvp
SCOPe Domain Coordinates for d4wa1f1:
Click to download the PDB-style file with coordinates for d4wa1f1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wa1f1:
View in 3D
