Lineage for d4wa1e2 (4wa1 E:330-503)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267733Species Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries)
  8. 2267738Domain d4wa1e2: 4wa1 E:330-503 [309801]
    Other proteins in same PDB: d4wa1a1, d4wa1b1, d4wa1c1, d4wa1d1, d4wa1e1, d4wa1f1
    automated match to d1ha0a2
    complexed with nag

Details for d4wa1e2

PDB Entry: 4wa1 (more details), 1.9 Å

PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4wa1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa1e2 h.3.1.0 (E:330-503) automated matches {Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik

SCOPe Domain Coordinates for d4wa1e2:

Click to download the PDB-style file with coordinates for d4wa1e2.
(The format of our PDB-style files is described here.)

Timeline for d4wa1e2: