![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311449] (2 PDB entries) |
![]() | Domain d4wa1e1: 4wa1 E:8-324 [309800] Other proteins in same PDB: d4wa1a2, d4wa1b2, d4wa1c2, d4wa1d2, d4wa1e2, d4wa1f2 automated match to d1ha0a1 complexed with nag |
PDB Entry: 4wa1 (more details), 1.9 Å
SCOPe Domain Sequences for d4wa1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa1e1 b.19.1.2 (E:8-324) Hemagglutinin {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]} nntatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgrdcklm dallgdphcdvfqdetwdlyverssassncypydvpdyaslrslvassgtlefitegftw tgvtqngesgackrgpangffsrlnwltksgsvypllnvtmpnndnfdklyvwgvhhpst nqeqtnlyvqasgrvtvstrrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins ngnlvaprgyfkmrtgkssimrsnapidtcisecitpngsipndkpfqnvnkitygacpk yvkqstlklatgmrnvp
Timeline for d4wa1e1: