![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries) |
![]() | Domain d4wa1c2: 4wa1 C:330-503 [309797] Other proteins in same PDB: d4wa1a1, d4wa1b1, d4wa1c1, d4wa1d1, d4wa1e1, d4wa1f1 automated match to d1ha0a2 complexed with nag |
PDB Entry: 4wa1 (more details), 1.9 Å
SCOPe Domain Sequences for d4wa1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa1c2 h.3.1.0 (C:330-503) automated matches {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]} glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik
Timeline for d4wa1c2: