Lineage for d4wa1a2 (4wa1 A:330-503)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041866Species Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId:1136533] [311450] (2 PDB entries)
  8. 3041867Domain d4wa1a2: 4wa1 A:330-503 [309793]
    Other proteins in same PDB: d4wa1a1, d4wa1b1, d4wa1c1, d4wa1d1, d4wa1e1, d4wa1f1
    automated match to d1ha0a2
    complexed with nag

Details for d4wa1a2

PDB Entry: 4wa1 (more details), 1.9 Å

PDB Description: the crystal structure of hemagglutinin from a h3n8 influenza virus isolated from new england harbor seals
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4wa1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa1a2 h.3.1.0 (A:330-503) automated matches {Influenza A virus (a/harbor seal/massachusetts/1/2011(h3n8)) [TaxId: 1136533]}
glfgaiagfiengwegmidgwygfrhknsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekeflevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqik

SCOPe Domain Coordinates for d4wa1a2:

Click to download the PDB-style file with coordinates for d4wa1a2.
(The format of our PDB-style files is described here.)

Timeline for d4wa1a2: