Lineage for d4w65a_ (4w65 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781197Species Mycobacterium fortuitum [TaxId:1214102] [311447] (1 PDB entry)
  8. 2781198Domain d4w65a_: 4w65 A: [309786]
    automated match to d2hyka_
    complexed with ca, edo

Details for d4w65a_

PDB Entry: 4w65 (more details), 1.38 Å

PDB Description: Crystal Structure of Glycosyl hydrolase family protein from Mycobacterium fortuitum
PDB Compounds: (A:) Glycosyl hydrolase family protein

SCOPe Domain Sequences for d4w65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w65a_ b.29.1.0 (A:) automated matches {Mycobacterium fortuitum [TaxId: 1214102]}
vnyvfadefdgpagsspntskwtiakaretikdptyweqpgrigqyrddrknafldgkgn
lviratkegdtyygaklasvweggaghtwearikfncltagawpafwlgtlgegeldive
wygngkwpsattvhaksnggewethniavdtawhtwrtqwdangarfwqdytegakpyfe
vsasqlpdwpfnqpgytmfvvlnlavagsggedpsggtypadmlvdyvrvw

SCOPe Domain Coordinates for d4w65a_:

Click to download the PDB-style file with coordinates for d4w65a_.
(The format of our PDB-style files is described here.)

Timeline for d4w65a_: