| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Mycobacterium fortuitum [TaxId:1214102] [311447] (1 PDB entry) |
| Domain d4w65a_: 4w65 A: [309786] automated match to d2hyka_ complexed with ca, edo |
PDB Entry: 4w65 (more details), 1.38 Å
SCOPe Domain Sequences for d4w65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w65a_ b.29.1.0 (A:) automated matches {Mycobacterium fortuitum [TaxId: 1214102]}
vnyvfadefdgpagsspntskwtiakaretikdptyweqpgrigqyrddrknafldgkgn
lviratkegdtyygaklasvweggaghtwearikfncltagawpafwlgtlgegeldive
wygngkwpsattvhaksnggewethniavdtawhtwrtqwdangarfwqdytegakpyfe
vsasqlpdwpfnqpgytmfvvlnlavagsggedpsggtypadmlvdyvrvw
Timeline for d4w65a_: