Lineage for d4w4ub_ (4w4u B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2021327Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2021328Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2021329Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2021336Protein Sus1 [310814] (1 species)
  7. 2021337Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (13 PDB entries)
  8. 2021367Domain d4w4ub_: 4w4u B: [309780]
    automated match to d3fwbc_
    complexed with zn; mutant

Details for d4w4ub_

PDB Entry: 4w4u (more details), 2.8 Å

PDB Description: structure of yeast saga dubm with sgf73 y57a mutant at 2.8 angstroms resolution
PDB Compounds: (B:) Transcription and mRNA export factor SUS1

SCOPe Domain Sequences for d4w4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w4ub_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
ilstvepkalemvsdstretvlkqirefleeivdtq

SCOPe Domain Coordinates for d4w4ub_:

Click to download the PDB-style file with coordinates for d4w4ub_.
(The format of our PDB-style files is described here.)

Timeline for d4w4ub_: