Lineage for d4w1wb_ (4w1w B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149015Species Mycobacterium tuberculosis [TaxId:1773] [225404] (27 PDB entries)
  8. 2149049Domain d4w1wb_: 4w1w B: [309777]
    automated match to d4wyda_
    complexed with 3g8, cl, edo, plp

Details for d4w1wb_

PDB Entry: 4w1w (more details), 1.9 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 7-(diethylamino)-3- (thiophene-2-carbonyl)-2h-chromen-2-one
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4w1wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w1wb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
evarlvgs

SCOPe Domain Coordinates for d4w1wb_:

Click to download the PDB-style file with coordinates for d4w1wb_.
(The format of our PDB-style files is described here.)

Timeline for d4w1wb_: