Lineage for d4v1za_ (4v1z A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051184Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2051246Protein automated matches [190170] (17 species)
    not a true protein
  7. 2051247Species Aspergillus fumigatus [TaxId:746128] [311446] (2 PDB entries)
  8. 2051249Domain d4v1za_: 4v1z A: [309774]
    automated match to d3pfza_
    complexed with nag, zn

Details for d4v1za_

PDB Entry: 4v1z (more details), 1.78 Å

PDB Description: the 3-d structure of the cellobiohydrolase, cel7a, from aspergillus fumigatus
PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d4v1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v1za_ b.29.1.10 (A:) automated matches {Aspergillus fumigatus [TaxId: 746128]}
eqvgtsqaevhpsmtwqsctaggscttnngkvvidanwrwvhkvgdytncytgntwdtti
cpddatcasncaleganyestygvtasgnslrlnfvttsqqknigsrlymmkddstyemf
kllnqeftfdvdvsnlpcglngalyfvamdadggmskyptnkagakygtgycdsqcprdl
kfingqanvegwqpssndanagtgnhgsccaemdiweansistaftphpcdtpgqvmctg
dacggtyssdryggtcdpdgcdfnsfrqgnktfygpgmtvdtkskftvvtqfitddgtss
gtlkeikrfyvqngkvipnsestwtgvsgnsitteyctaqkslfqdqnvfekhgglegmg
aalaqgmvlvmslwddhsanmlwldsnypttassttpgvargtcdissgvpadveanhpd
ayvvysnikvgpigstfnsg

SCOPe Domain Coordinates for d4v1za_:

Click to download the PDB-style file with coordinates for d4v1za_.
(The format of our PDB-style files is described here.)

Timeline for d4v1za_: