![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.7: LysM domain [54105] (1 superfamily) beta-alpha(2)-beta; antiparallel strands |
![]() | Superfamily d.7.1: LysM domain [54106] (2 families) ![]() automatically mapped to Pfam PF01476 |
![]() | Family d.7.1.0: automated matches [234000] (1 protein) not a true family |
![]() | Protein automated matches [234001] (7 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries) |
![]() | Domain d4uz2c2: 4uz2 C:63-113 [309769] automated match to d4uz3c_ |
PDB Entry: 4uz2 (more details), 2.5 Å
SCOPe Domain Sequences for d4uz2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uz2c2 d.7.1.0 (C:63-113) automated matches {Thermus thermophilus [TaxId: 300852]} rerthvvapgdtlfslarrygttvealmrlnglsspeikvgqvlrlpeege
Timeline for d4uz2c2: