Lineage for d4uz2a2 (4uz2 A:63-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928808Fold d.7: LysM domain [54105] (1 superfamily)
    beta-alpha(2)-beta; antiparallel strands
  4. 2928809Superfamily d.7.1: LysM domain [54106] (2 families) (S)
    automatically mapped to Pfam PF01476
  5. 2928818Family d.7.1.0: automated matches [234000] (1 protein)
    not a true family
  6. 2928819Protein automated matches [234001] (7 species)
    not a true protein
  7. 2928849Species Thermus thermophilus [TaxId:300852] [268982] (2 PDB entries)
  8. 2928856Domain d4uz2a2: 4uz2 A:63-114 [309765]
    automated match to d4uz3c_

Details for d4uz2a2

PDB Entry: 4uz2 (more details), 2.5 Å

PDB Description: crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus
PDB Compounds: (A:) cell wall-binding endopeptidase-related protein

SCOPe Domain Sequences for d4uz2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uz2a2 d.7.1.0 (A:63-114) automated matches {Thermus thermophilus [TaxId: 300852]}
rerthvvapgdtlfslarrygttvealmrlnglsspeikvgqvlrlpeegea

SCOPe Domain Coordinates for d4uz2a2:

Click to download the PDB-style file with coordinates for d4uz2a2.
(The format of our PDB-style files is described here.)

Timeline for d4uz2a2: