Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein Triosephosphate isomerase [51353] (20 species) |
Species Human (Homo sapiens) [TaxId:9606] [51355] (7 PDB entries) |
Domain d4unla_: 4unl A: [309743] automated match to d1wyia_ mutant |
PDB Entry: 4unl (more details), 1.5 Å
SCOPe Domain Sequences for d4unla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unla_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]} srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava aqncykvtdgaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd iinakq
Timeline for d4unla_: