SCOPe 2.06: Domain d4unla_: 4unl A:

Lineage for d4unla_ (4unl A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51355] (7 PDB entries)

8. Domain d4unla_: 4unl A: [309743]
   automated match to d1wyia_
   mutant

Details for d4unla_

PDB Entry: 4unl, 1.5 Å

PDB Description: Crystal structure of a single mutant (N71D) of triosephosphate isomerase from human

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4unla_:

Sequence; same for both SEQRES and ATOM records:

>d4unla_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtdgaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

Timeline for d4unla_:

• d4unla_ is new in SCOPe 2.06-stable
  
• d4unla_ appears in SCOPe 2.07
  
• d4unla_ appears in the current release, SCOPe 2.08