Lineage for d4unla_ (4unl A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413294Species Human (Homo sapiens) [TaxId:9606] [51355] (9 PDB entries)
  8. 2413295Domain d4unla_: 4unl A: [309743]
    automated match to d1wyia_
    mutant

Details for d4unla_

PDB Entry: 4unl (more details), 1.5 Å

PDB Description: Crystal structure of a single mutant (N71D) of triosephosphate isomerase from human
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4unla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unla_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtdgaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

SCOPe Domain Coordinates for d4unla_:

Click to download the PDB-style file with coordinates for d4unla_.
(The format of our PDB-style files is described here.)

Timeline for d4unla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4unlb_