Lineage for d4ulng_ (4uln G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418634Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2418635Protein automated matches [190568] (9 species)
    not a true protein
  7. 2418650Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (22 PDB entries)
  8. 2418672Domain d4ulng_: 4uln G: [309740]
    automated match to d3frxd_
    protein/RNA complex; complexed with 3k5, mg, ohx, zn

Details for d4ulng_

PDB Entry: 4uln (more details), 3.1 Å

PDB Description: Crystal structure of Phyllanthoside bound to the yeast 80S ribosome
PDB Compounds: (G:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d4ulng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ulng_ b.69.4.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
fagytdnvirvwqvmtan

SCOPe Domain Coordinates for d4ulng_:

Click to download the PDB-style file with coordinates for d4ulng_.
(The format of our PDB-style files is described here.)

Timeline for d4ulng_: