Lineage for d4ul9h_ (4ul9 h:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075962Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2075963Protein automated matches [190568] (6 species)
    not a true protein
  7. 2075977Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267880] (19 PDB entries)
  8. 2075993Domain d4ul9h_: 4ul9 h: [309737]
    automated match to d3frxd_
    protein/RNA complex; complexed with mg, ohx, zn

Details for d4ul9h_

PDB Entry: 4ul9 (more details), 3 Å

PDB Description: Crystal structure of Nagilactone C bound to the yeast 80S ribosome
PDB Compounds: (h:) Guanine nucleotide-binding protein subunit beta-like protein

SCOPe Domain Sequences for d4ul9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ul9h_ b.69.4.0 (h:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
fagytdnvirvwqvmtan

SCOPe Domain Coordinates for d4ul9h_:

Click to download the PDB-style file with coordinates for d4ul9h_.
(The format of our PDB-style files is described here.)

Timeline for d4ul9h_: