Lineage for d1c2ya_ (1c2y A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21611Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily)
  4. 21612Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) (S)
  5. 21613Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein)
  6. 21614Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species)
  7. 21663Species Spinach (Spinacia oleracea) [TaxId:3562] [52127] (1 PDB entry)
  8. 21664Domain d1c2ya_: 1c2y A: [30972]

Details for d1c2ya_

PDB Entry: 1c2y (more details), 3.3 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly

SCOP Domain Sequences for d1c2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ya_ c.16.1.1 (A:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Spinach (Spinacia oleracea)}
mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
mdqainraggkagnkgaesaltaiemaslfehhlk

SCOP Domain Coordinates for d1c2ya_:

Click to download the PDB-style file with coordinates for d1c2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c2ya_: