Lineage for d1c2ya_ (1c2y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854561Protein Lumazine synthase [52123] (7 species)
  7. 2854698Species Spinach (Spinacia oleracea) [TaxId:3562] [52127] (1 PDB entry)
  8. 2854699Domain d1c2ya_: 1c2y A: [30972]
    complexed with lmz

Details for d1c2ya_

PDB Entry: 1c2y (more details), 3.3 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
PDB Compounds: (A:) protein (lumazine synthase)

SCOPe Domain Sequences for d1c2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c2ya_ c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
mdqainraggkagnkgaesaltaiemaslfehhlk

SCOPe Domain Coordinates for d1c2ya_:

Click to download the PDB-style file with coordinates for d1c2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1c2ya_: