Lineage for d4udba_ (4udb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2009721Domain d4udba_: 4udb A: [309714]
    automated match to d3mnea_
    complexed with cv7, dms, gol, so4

Details for d4udba_

PDB Entry: 4udb (more details), 2.36 Å

PDB Description: mr in complex with desisobutyrylciclesonide
PDB Compounds: (A:) Mineralocorticoid receptor

SCOPe Domain Sequences for d4udba_:

Sequence, based on SEQRES records: (download)

>d4udba_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvkwakvlpgfknlple
dqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqis
lqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgq
swqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgna
kplyfhr

Sequence, based on observed residues (ATOM records): (download)

>d4udba_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spvmvleniepeivyagydpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqi
tliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqf
vrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgqswq
rfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakpl
yfhr

SCOPe Domain Coordinates for d4udba_:

Click to download the PDB-style file with coordinates for d4udba_.
(The format of our PDB-style files is described here.)

Timeline for d4udba_:

  • d4udba_ is new in SCOPe 2.06-stable