Lineage for d1c41j_ (1c41 J:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67948Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 67949Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 67950Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 67951Protein Lumazine synthase [52123] (5 species)
  7. 67995Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [52126] (1 PDB entry)
  8. 68005Domain d1c41j_: 1c41 J: [30971]

Details for d1c41j_

PDB Entry: 1c41 (more details), 3.1 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly

SCOP Domain Sequences for d1c41j_:

Sequence, based on SEQRES records: (download)

>d1c41j_ c.16.1.1 (J:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea)}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvlikge
tmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedwglaa
vemgvrrrdwaagkt

Sequence, based on observed residues (ATOM records): (download)

>d1c41j_ c.16.1.1 (J:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea)}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt

SCOP Domain Coordinates for d1c41j_:

Click to download the PDB-style file with coordinates for d1c41j_.
(The format of our PDB-style files is described here.)

Timeline for d1c41j_: