Lineage for d1c41j_ (1c41 J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854561Protein Lumazine synthase [52123] (7 species)
  7. 2854687Species Fungus (Magnaporthe grisea) [TaxId:148305] [52126] (1 PDB entry)
  8. 2854697Domain d1c41j_: 1c41 J: [30971]
    complexed with lmz, so4

Details for d1c41j_

PDB Entry: 1c41 (more details), 3.1 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
PDB Compounds: (J:) lumazine synthase

SCOPe Domain Sequences for d1c41j_:

Sequence, based on SEQRES records: (download)

>d1c41j_ c.16.1.1 (J:) Lumazine synthase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvlikge
tmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedwglaa
vemgvrrrdwaagkt

Sequence, based on observed residues (ATOM records): (download)

>d1c41j_ c.16.1.1 (J:) Lumazine synthase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt

SCOPe Domain Coordinates for d1c41j_:

Click to download the PDB-style file with coordinates for d1c41j_.
(The format of our PDB-style files is described here.)

Timeline for d1c41j_: