Lineage for d4ubha_ (4ubh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404257Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 protein domains)
    Pfam PF05995, CDO_I
  6. 2404258Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2404266Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)
  8. 2404312Domain d4ubha_: 4ubh A: [309703]
    automated match to d3elna_
    complexed with cl, fe2, na

Details for d4ubha_

PDB Entry: 4ubh (more details), 1.81 Å

PDB Description: resting state of rat cysteine dioxygenase y157f variant
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4ubha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubha_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlfsppfdtchafdqrtghknkvtmtfhs
kfgirtp

SCOPe Domain Coordinates for d4ubha_:

Click to download the PDB-style file with coordinates for d4ubha_.
(The format of our PDB-style files is described here.)

Timeline for d4ubha_: