SCOPe 2.08: Domain d4uafe_: 4uaf E:

Lineage for d4uafe_ (4uaf E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
   alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet

4. Superfamily d.361.1: PB2 C-terminal domain-like [160453] (2 families)

5. Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
   C-terminal part of Pfam PF00604

6. Protein Polymerase basic protein 2, PB2 [160455] (5 species)

7. Species Influenza A virus, different strains [TaxId:11320] [160456] (5 PDB entries)
   Uniprot P31345 685-759

8. Domain d4uafe_: 4uaf E: [309702]
   Other proteins in same PDB: d4uafb_
   automated match to d2gmoa1
   complexed with po4

Details for d4uafe_

PDB Entry: 4uaf, 1.7 Å

PDB Description: importin alpha 1 delta ibb in complex with influenza pb2 nuclear localization domain

PDB Compounds: (E:) Polymerase basic protein 2

SCOPe Domain Sequences for d4uafe_:

Sequence; same for both SEQRES and ATOM records:

>d4uafe_ d.361.1.1 (E:) Polymerase basic protein 2, PB2 {Influenza A virus, different strains [TaxId: 11320]}
esavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssiltd
sqtatkrirmai

Timeline for d4uafe_:

• d4uafe_ first appeared in SCOPe 2.06
  
• d4uafe_ appears in SCOPe 2.07