Lineage for d4uafb_ (4uaf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332676Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2332717Protein Importin alpha [48376] (1 species)
  7. 2332718Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2332722Domain d4uafb_: 4uaf B: [309701]
    Other proteins in same PDB: d4uafe_
    automated match to d1q1sc_
    complexed with po4

Details for d4uafb_

PDB Entry: 4uaf (more details), 1.7 Å

PDB Description: importin alpha 1 delta ibb in complex with influenza pb2 nuclear localization domain
PDB Compounds: (B:) Importin subunit alpha-1

SCOPe Domain Sequences for d4uafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uafb_ a.118.1.1 (B:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyf

SCOPe Domain Coordinates for d4uafb_:

Click to download the PDB-style file with coordinates for d4uafb_.
(The format of our PDB-style files is described here.)

Timeline for d4uafb_: