Lineage for d4u7fb_ (4u7f B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.3: Quinone reductase [52235] (4 proteins)
binds FADProtein Quinone reductase type 2 (menadione reductase) [52240] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries) 
Domain d4u7fb_: 4u7f B: [309688]
automated match to d1qr2a_
complexed with fad, k25, zn
Details for d4u7fb_
PDB Entry: 4u7f (more details), 1.8 Å
PDB Description: reduced quinone reductase 2 in complex with ck2 inhibitor dmat
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]SCOPe Domain Sequences for d4u7fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u7fb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
SCOPe Domain Coordinates for d4u7fb_:
Click to download the PDB-style file with coordinates for d4u7fb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4u7fb_:
- d4u7fb_ first appeared in SCOPe 2.06
- d4u7fb_ appears in SCOPe 2.07
View in 3D
