Lineage for d4u7fb_ (4u7f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856520Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2856618Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2856619Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)
  8. 2856698Domain d4u7fb_: 4u7f B: [309688]
    automated match to d1qr2a_
    complexed with fad, k25, zn

Details for d4u7fb_

PDB Entry: 4u7f (more details), 1.8 Å

PDB Description: reduced quinone reductase 2 in complex with ck2 inhibitor dmat
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d4u7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u7fb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d4u7fb_:

Click to download the PDB-style file with coordinates for d4u7fb_.
(The format of our PDB-style files is described here.)

Timeline for d4u7fb_: