![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily) |
![]() | Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) ![]() |
![]() | Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein) |
![]() | Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species) |
![]() | Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [52126] (1 PDB entry) |
![]() | Domain d1c41g_: 1c41 G: [30968] |
PDB Entry: 1c41 (more details), 3.1 Å
SCOP Domain Sequences for d1c41g_:
Sequence, based on SEQRES records: (download)
>d1c41g_ c.16.1.1 (G:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)} gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi avqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvlikge tmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedwglaa vemgvrrrdwaagkt
>d1c41g_ c.16.1.1 (G:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)} gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
Timeline for d1c41g_: