Lineage for d4twwa_ (4tww A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066547Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2066606Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2066628Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2066713Domain d4twwa_: 4tww A: [309672]
    automated match to d1z1ja_
    complexed with 3a7

Details for d4twwa_

PDB Entry: 4tww (more details), 2.42 Å

PDB Description: Structure of SARS-3CL protease complex with a Bromobenzoyl (S,R)-N-decalin type inhibitor
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d4twwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4twwa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdiqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d4twwa_:

Click to download the PDB-style file with coordinates for d4twwa_.
(The format of our PDB-style files is described here.)

Timeline for d4twwa_: