Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cyp119 [48278] (3 species) thermophilic P450 |
Species Sulfolobus acidocaldarius [TaxId:330779] [311443] (4 PDB entries) |
Domain d4tuva_: 4tuv A: [309671] automated match to d1f4ta_ complexed with cpz, hem |
PDB Entry: 4tuv (more details), 2.5 Å
SCOPe Domain Sequences for d4tuva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tuva_ a.104.1.1 (A:) Cyp119 {Sulfolobus acidocaldarius [TaxId: 330779]} mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl vvrlksn
Timeline for d4tuva_: