Lineage for d4tt5a_ (4tt5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004934Protein Cyp119 [48278] (3 species)
    thermophilic P450
  7. 2004935Species Sulfolobus acidocaldarius [TaxId:330779] [311443] (4 PDB entries)
  8. 2004938Domain d4tt5a_: 4tt5 A: [309670]
    automated match to d1f4ta_
    complexed with 36y, gol, hem

Details for d4tt5a_

PDB Entry: 4tt5 (more details), 2.18 Å

PDB Description: crystal structure of cyp119 from sulfolobus acidocaldarius, complexed with 4-(4-bromophenyl)-1h imidazole
PDB Compounds: (A:) cytochrome p450 119

SCOPe Domain Sequences for d4tt5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tt5a_ a.104.1.1 (A:) Cyp119 {Sulfolobus acidocaldarius [TaxId: 330779]}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlksn

SCOPe Domain Coordinates for d4tt5a_:

Click to download the PDB-style file with coordinates for d4tt5a_.
(The format of our PDB-style files is described here.)

Timeline for d4tt5a_:

  • d4tt5a_ is new in SCOPe 2.06-stable