| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Tumor necrosis factor (TNF) [49848] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
| Domain d4tswf_: 4tsw F: [309669] automated match to d5tswa_ mutant |
PDB Entry: 4tsw (more details), 2.5 Å
SCOPe Domain Sequences for d4tswf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tswf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
cpsthvllthtisriavsyqtkvnllsaikspcqrtpegaeakpwyepiylggvfqlekg
drlsaeinrpdyldfaesgqvyfgiial
Timeline for d4tswf_: