![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Tumor necrosis factor (TNF) [49848] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
![]() | Domain d4tswd_: 4tsw D: [309667] automated match to d5tswa_ mutant |
PDB Entry: 4tsw (more details), 2.5 Å
SCOPe Domain Sequences for d4tswd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tswd_ b.22.1.1 (D:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg cpsthvllthtisriavsyqtkvnllsaikspcqrtpegaeakpwyepiylggvfqlekg drlsaeinrpdyldfaesgqvyfgiial
Timeline for d4tswd_: