SCOPe 2.08: Domain d4tsub_: 4tsu B:

Lineage for d4tsub_ (4tsu B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein automated matches [260878] (1 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)

8. Domain d4tsub_: 4tsu B: [309663]
   automated match to d3t8nb_
   complexed with equ

Details for d4tsub_

PDB Entry: 4tsu, 2.5 Å

PDB Description: crystal structure of ketosteroid isomerase complexed with inhibitor

PDB Compounds: (B:) Ketosteroid Isomerase

SCOPe Domain Sequences for d4tsub_:

Sequence, based on SEQRES records:

>d4tsub_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records):

>d4tsub_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

Timeline for d4tsub_:

• d4tsub_ first appeared in SCOPe 2.06
  
• d4tsub_ appears in SCOPe 2.07