Lineage for d4tsub_ (4tsu B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162085Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2162262Protein automated matches [260878] (1 species)
    not a true protein
  7. 2162263Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)
  8. 2162264Domain d4tsub_: 4tsu B: [309663]
    automated match to d3t8nb_
    complexed with equ

Details for d4tsub_

PDB Entry: 4tsu (more details), 2.5 Å

PDB Description: crystal structure of ketosteroid isomerase complexed with inhibitor
PDB Compounds: (B:) Ketosteroid Isomerase

SCOPe Domain Sequences for d4tsub_:

Sequence, based on SEQRES records: (download)

>d4tsub_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d4tsub_ d.17.4.3 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOPe Domain Coordinates for d4tsub_:

Click to download the PDB-style file with coordinates for d4tsub_.
(The format of our PDB-style files is described here.)

Timeline for d4tsub_:

  • d4tsub_ is new in SCOPe 2.06-stable