Lineage for d4tmcb_ (4tmc B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091728Protein automated matches [190228] (18 species)
    not a true protein
  7. 2091743Species Kluyveromyces marxianus [TaxId:4911] [311442] (2 PDB entries)
  8. 2091745Domain d4tmcb_: 4tmc B: [309660]
    automated match to d3tx9a_
    complexed with fmn, hba

Details for d4tmcb_

PDB Entry: 4tmc (more details), 1.8 Å

PDB Description: crystal structure of old yellow enzyme from candida macedoniensis aku4588 complexed with p-hydroxybenzaldehyde
PDB Compounds: (B:) old yellow enzyme

SCOPe Domain Sequences for d4tmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tmcb_ c.1.4.1 (B:) automated matches {Kluyveromyces marxianus [TaxId: 4911]}
msymnfdpkplgdtnifkpikignnelkhrvvmpaltrmraiapgnipntewaeeyyrqr
sqypgtliitegtfpsaqsggypnvpgiwskeqlaewkkifnaihenksfvwvqlwvlgr
qawpevlkkeglrydsatddlymgeeekeralkannpqhgitkeeikqyikeyvdaakka
idagadgvqihsangyllnqfldpisnnrtdeyggsienrarftlevvdavvdavgaert
sirfspygtfgtmsggenpgivaqyayvigelekraragkrlafidlveprvtdpflpef
ekwfkegtnefiysiwkgpvlrvgnyaldpdqatldskkpntligygrsfianpdlvyrl
ekglplnkydrntfytftkegytdypsyeesvakgykk

SCOPe Domain Coordinates for d4tmcb_:

Click to download the PDB-style file with coordinates for d4tmcb_.
(The format of our PDB-style files is described here.)

Timeline for d4tmcb_: