Lineage for d1c41e_ (1c41 E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21611Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily)
  4. 21612Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) (S)
  5. 21613Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein)
  6. 21614Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species)
  7. 21652Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [52126] (1 PDB entry)
  8. 21657Domain d1c41e_: 1c41 E: [30966]

Details for d1c41e_

PDB Entry: 1c41 (more details), 3.1 Å

PDB Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly

SCOP Domain Sequences for d1c41e_:

Sequence, based on SEQRES records: (download)

>d1c41e_ c.16.1.1 (E:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvlikge
tmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedwglaa
vemgvrrrdwaagkt

Sequence, based on observed residues (ATOM records): (download)

>d1c41e_ c.16.1.1 (E:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)}
gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt

SCOP Domain Coordinates for d1c41e_:

Click to download the PDB-style file with coordinates for d1c41e_.
(The format of our PDB-style files is described here.)

Timeline for d1c41e_: