Lineage for d4tmbb_ (4tmb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080404Species Kluyveromyces marxianus [TaxId:4911] [311442] (2 PDB entries)
  8. 2080410Domain d4tmbb_: 4tmb B: [309656]
    automated match to d3tx9a_
    complexed with fmn

Details for d4tmbb_

PDB Entry: 4tmb (more details), 1.8 Å

PDB Description: crystal structure of old yellow enzyme from candida macedoniensis aku4588
PDB Compounds: (B:) old yellow enzyme

SCOPe Domain Sequences for d4tmbb_:

Sequence, based on SEQRES records: (download)

>d4tmbb_ c.1.4.1 (B:) automated matches {Kluyveromyces marxianus [TaxId: 4911]}
ymnfdpkplgdtnifkpikignnelkhrvvmpaltrmraiapgnipntewaeeyyrqrsq
ypgtliitegtfpsaqsggypnvpgiwskeqlaewkkifnaihenksfvwvqlwvlgrqa
wpevlkkeglrydsatddlymgeeekeralkannpqhgitkeeikqyikeyvdaakkaid
agadgvqihsangyllnqfldpisnnrtdeyggsienrarftlevvdavvdavgaertsi
rfspygtfgtmsggenpgivaqyayvigelekraragkrlafidlveprvtdpflpefek
wfkegtnefiysiwkgpvlrvgnyaldpdqatldskkpntligygrsfianpdlvyrlek
glplnkydrntfytftkegytdypsyeesv

Sequence, based on observed residues (ATOM records): (download)

>d4tmbb_ c.1.4.1 (B:) automated matches {Kluyveromyces marxianus [TaxId: 4911]}
ymnfdpkplgdtnifkpikignnelkhrvvmpaltrmraiapgnipntewaeeyyrqrsq
ypgtliitegtfpsaqsggypnvpgiwskeqlaewkkifnaihenksfvwvqlwvlgrqa
wpevlkkeglrydsatddlymgeeekeralkannpqhgitkeeikqyikeyvdaakkaid
agadgvqihsangyllnqfldpisnnrtdeyggsienrarftlevvdavvdavgaertsi
rfspygtfgtmsggenpgivaqyayvigelekraragkrlafidlvepgtnefiysiwkg
pvlrvgnyaldpdqatldskkpntligygrsfianpdlvyrlekglplnkydrntfytft
kegytdypsyeesv

SCOPe Domain Coordinates for d4tmbb_:

Click to download the PDB-style file with coordinates for d4tmbb_.
(The format of our PDB-style files is described here.)

Timeline for d4tmbb_:

  • d4tmbb_ is new in SCOPe 2.06-stable