![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
![]() | Protein automated matches [191087] (19 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:509170] [273929] (2 PDB entries) |
![]() | Domain d4s0mh_: 4s0m H: [309641] automated match to d4w98a_ complexed with mg |
PDB Entry: 4s0m (more details), 1.92 Å
SCOPe Domain Sequences for d4s0mh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s0mh_ d.58.6.0 (H:) automated matches {Acinetobacter baumannii [TaxId: 509170]} maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd svasaereiayffadneicprtr
Timeline for d4s0mh_: