Lineage for d4s0mb_ (4s0m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951622Species Acinetobacter baumannii [TaxId:509170] [273929] (2 PDB entries)
  8. 2951625Domain d4s0mb_: 4s0m B: [309636]
    automated match to d4w98a_
    complexed with mg

Details for d4s0mb_

PDB Entry: 4s0m (more details), 1.92 Å

PDB Description: Crystal Structure of nucleoside diphosphate kinase at 1.92 A resolution from acinetobacter baumannii
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4s0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s0mb_ d.58.6.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509170]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr

SCOPe Domain Coordinates for d4s0mb_:

Click to download the PDB-style file with coordinates for d4s0mb_.
(The format of our PDB-style files is described here.)

Timeline for d4s0mb_: