Lineage for d4s0la_ (4s0l A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528103Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2528104Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2528120Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
    Pfam PF08915
  6. 2528128Protein automated matches [310853] (2 species)
    not a true protein
  7. 2528129Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)
  8. 2528139Domain d4s0la_: 4s0l A: [309634]
    automated match to d1y2qa_
    mutant

Details for d4s0la_

PDB Entry: 4s0l (more details), 2.5 Å

PDB Description: biphenylalanine modified threonyl-trna synthetase from pyrococcus abyssi: i11bif, y79v, and f123v mutant
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4s0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s0la_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvvpwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
iavkisckghplaelsrtivpe

SCOPe Domain Coordinates for d4s0la_:

Click to download the PDB-style file with coordinates for d4s0la_.
(The format of our PDB-style files is described here.)

Timeline for d4s0la_: