![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
![]() | Superfamily c.110.1: DTD-like [69500] (3 families) ![]() active form is a dimer |
![]() | Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins) Pfam PF08915 |
![]() | Protein automated matches [310853] (2 species) not a true protein |
![]() | Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries) |
![]() | Domain d4s0la_: 4s0l A: [309634] automated match to d1y2qa_ mutant |
PDB Entry: 4s0l (more details), 2.5 Å
SCOPe Domain Sequences for d4s0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s0la_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 272844]} mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka ieeiskvaeqvkaenvfvvpwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy iavkisckghplaelsrtivpe
Timeline for d4s0la_: