SCOPe 2.07: Domain d4s0la_: 4s0l A:

Lineage for d4s0la_ (4s0l A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (3 families)
   active form is a dimer

5. Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 protein domains)
   Pfam PF08915

6. Protein automated matches [310853] (2 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)

8. Domain d4s0la_: 4s0l A: [309634]
   automated match to d1y2qa_
   mutant

Details for d4s0la_

PDB Entry: 4s0l, 2.5 Å

PDB Description: biphenylalanine modified threonyl-trna synthetase from pyrococcus abyssi: i11bif, y79v, and f123v mutant

PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4s0la_:

Sequence; same for both SEQRES and ATOM records:

>d4s0la_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvvpwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
iavkisckghplaelsrtivpe

Timeline for d4s0la_:

• d4s0la_ first appeared in SCOPe 2.06