SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4s03a_ (4s03 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149822Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2149823Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2149839Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 protein domains)
    Pfam PF08915
  6. 2149847Protein automated matches [310853] (2 species)
    not a true protein
  7. 2149848Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)
  8. 2149854Domain d4s03a_: 4s03 A: [309630]
    automated match to d1y2qa_
    mutant

Details for d4s03a_

PDB Entry: 4s03 (more details), 2.05 Å

PDB Description: biphenylalanine modified threonyl-trna synthetase from pyrococcus abyssi: i11bif, y79i, and f123a mutant
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4s03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s03a_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvipwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
iaakisckghplaelsrtivp

SCOPe Domain Coordinates for d4s03a_:

Click to download the PDB-style file with coordinates for d4s03a_.
(The format of our PDB-style files is described here.)

Timeline for d4s03a_:

  • d4s03a_ is new in SCOPe 2.06-stable