Lineage for d4s03a_ (4s03 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920866Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
    Pfam PF08915
  6. 2920874Protein automated matches [310853] (2 species)
    not a true protein
  7. 2920875Species Pyrococcus abyssi [TaxId:272844] [311435] (8 PDB entries)
  8. 2920881Domain d4s03a_: 4s03 A: [309630]
    automated match to d1y2qa_
    mutant

Details for d4s03a_

PDB Entry: 4s03 (more details), 2.05 Å

PDB Description: biphenylalanine modified threonyl-trna synthetase from pyrococcus abyssi: i11bif, y79i, and f123a mutant
PDB Compounds: (A:) Threonine--tRNA ligase

SCOPe Domain Sequences for d4s03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s03a_ c.110.1.2 (A:) automated matches {Pyrococcus abyssi [TaxId: 272844]}
mrvllihadyfeyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvipwahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
iaakisckghplaelsrtivp

SCOPe Domain Coordinates for d4s03a_:

Click to download the PDB-style file with coordinates for d4s03a_.
(The format of our PDB-style files is described here.)

Timeline for d4s03a_: