Lineage for d4rztb_ (4rzt B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520549Protein automated matches [190296] (11 species)
    not a true protein
  7. 2520564Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries)
  8. 2520570Domain d4rztb_: 4rzt B: [309626]
    automated match to d3edca_
    complexed with 40j

Details for d4rztb_

PDB Entry: 4rzt (more details), 3.1 Å

PDB Description: lac repressor engineered to bind sucralose, sucralose-bound tetramer
PDB Compounds: (B:) lac repressor

SCOPe Domain Sequences for d4rztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rztb_ c.93.1.1 (B:) automated matches {Escherichia coli [TaxId: 536056]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalghqq
iallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl

SCOPe Domain Coordinates for d4rztb_:

Click to download the PDB-style file with coordinates for d4rztb_.
(The format of our PDB-style files is described here.)

Timeline for d4rztb_: