Lineage for d4rzta_ (4rzt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913178Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries)
  8. 2913179Domain d4rzta_: 4rzt A: [309625]
    automated match to d3edca_

Details for d4rzta_

PDB Entry: 4rzt (more details), 3.1 Å

PDB Description: lac repressor engineered to bind sucralose, sucralose-bound tetramer
PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d4rzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzta_ c.93.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
qslligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrv
sgliinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalgh
qqiallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivp
tamlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqt
svdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesg
q

SCOPe Domain Coordinates for d4rzta_:

Click to download the PDB-style file with coordinates for d4rzta_.
(The format of our PDB-style files is described here.)

Timeline for d4rzta_: