SCOPe 2.08: Domain d4rzsc_: 4rzs C:

Lineage for d4rzsc_ (4rzs C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries)

8. Domain d4rzsc_: 4rzs C: [309623]
   Other proteins in same PDB: d4rzsa1, d4rzsb1
   automated match to d3edca_
   complexed with gol

Details for d4rzsc_

PDB Entry: 4rzs, 2.71 Å

PDB Description: lac repressor engineered to bind sucralose, unliganded tetramer

PDB Compounds: (C:) lac repressor

SCOPe Domain Sequences for d4rzsc_:

Sequence; same for both SEQRES and ATOM records:

>d4rzsc_ c.93.1.1 (C:) automated matches {Escherichia coli [TaxId: 536056]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalghq
qiallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrles

Timeline for d4rzsc_:

• d4rzsc_ first appeared in SCOPe 2.06
  
• d4rzsc_ appears in SCOPe 2.07