SCOPe 2.08: Domain d4rzsb2: 4rzs B:61-357

Lineage for d4rzsb2 (4rzs B:61-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries)

8. Domain d4rzsb2: 4rzs B:61-357 [309622]
   Other proteins in same PDB: d4rzsa1, d4rzsb1
   automated match to d1lbga2
   complexed with gol

Details for d4rzsb2

PDB Entry: 4rzs, 2.71 Å

PDB Description: lac repressor engineered to bind sucralose, unliganded tetramer

PDB Compounds: (B:) lac repressor

SCOPe Domain Sequences for d4rzsb2:

Sequence; same for both SEQRES and ATOM records:

>d4rzsb2 c.93.1.1 (B:61-357) automated matches {Escherichia coli [TaxId: 536056]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalghq
qiallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

Timeline for d4rzsb2:

• d4rzsb2 first appeared in SCOPe 2.06
  
• d4rzsb2 appears in SCOPe 2.07