Lineage for d4rzsb2 (4rzs B:61-357)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143939Protein automated matches [190296] (11 species)
    not a true protein
  7. 2143954Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries)
  8. 2143956Domain d4rzsb2: 4rzs B:61-357 [309622]
    Other proteins in same PDB: d4rzsa1, d4rzsb1
    automated match to d1lbga2
    complexed with gol

Details for d4rzsb2

PDB Entry: 4rzs (more details), 2.71 Å

PDB Description: lac repressor engineered to bind sucralose, unliganded tetramer
PDB Compounds: (B:) lac repressor

SCOPe Domain Sequences for d4rzsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzsb2 c.93.1.1 (B:61-357) automated matches {Escherichia coli [TaxId: 536056]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalghq
qiallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOPe Domain Coordinates for d4rzsb2:

Click to download the PDB-style file with coordinates for d4rzsb2.
(The format of our PDB-style files is described here.)

Timeline for d4rzsb2:

  • d4rzsb2 is new in SCOPe 2.06-stable