| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein automated matches [190296] (11 species) not a true protein |
| Species Escherichia coli [TaxId:536056] [311440] (2 PDB entries) |
| Domain d4rzsb2: 4rzs B:61-357 [309622] Other proteins in same PDB: d4rzsa1, d4rzsb1 automated match to d1lbga2 complexed with gol |
PDB Entry: 4rzs (more details), 2.71 Å
SCOPe Domain Sequences for d4rzsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rzsb2 c.93.1.1 (B:61-357) automated matches {Escherichia coli [TaxId: 536056]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfltasdqtplnsiifshedgtrlgvehlvalghq
qiallagplssvdarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
Timeline for d4rzsb2:
View in 3DDomains from other chains: (mouse over for more information) d4rzsa1, d4rzsa2, d4rzsc_, d4rzsd_ |