Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.16: beta-subunit of the lumazine synthase/riboflavin synthase complex [52120] (1 superfamily) |
Superfamily c.16.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52121] (1 family) |
Family c.16.1.1: beta-subunit of the lumazine synthase/riboflavin synthase complex [52122] (1 protein) |
Protein beta-subunit of the lumazine synthase/riboflavin synthase complex [52123] (4 species) |
Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [52126] (1 PDB entry) |
Domain d1c41a_: 1c41 A: [30962] |
PDB Entry: 1c41 (more details), 3.1 Å
SCOP Domain Sequences for d1c41a_:
Sequence, based on SEQRES records: (download)
>d1c41a_ c.16.1.1 (A:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)} gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi avqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvlikge tmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedwglaa vemgvrrrdwaagkt
>d1c41a_ c.16.1.1 (A:) beta-subunit of the lumazine synthase/riboflavin synthase complex {Rice blast fungus (Magnaporthe grisea)} gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
Timeline for d1c41a_: