Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (21 species) not a true protein |
Species Escherichia coli [TaxId:536056] [311441] (1 PDB entry) |
Domain d4rzsa1: 4rzs A:3-51 [309619] Other proteins in same PDB: d4rzsa2, d4rzsb2, d4rzsc_, d4rzsd_ automated match to d1lbga1 complexed with gol |
PDB Entry: 4rzs (more details), 2.71 Å
SCOPe Domain Sequences for d4rzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rzsa1 a.35.1.0 (A:3-51) automated matches {Escherichia coli [TaxId: 536056]} pvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr
Timeline for d4rzsa1:
View in 3D Domains from other chains: (mouse over for more information) d4rzsb1, d4rzsb2, d4rzsc_, d4rzsd_ |