Lineage for d4rzsa1 (4rzs A:3-51)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709849Species Escherichia coli [TaxId:536056] [311441] (1 PDB entry)
  8. 2709850Domain d4rzsa1: 4rzs A:3-51 [309619]
    Other proteins in same PDB: d4rzsa2, d4rzsb2, d4rzsc_, d4rzsd_
    automated match to d1lbga1
    complexed with gol

Details for d4rzsa1

PDB Entry: 4rzs (more details), 2.71 Å

PDB Description: lac repressor engineered to bind sucralose, unliganded tetramer
PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d4rzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzsa1 a.35.1.0 (A:3-51) automated matches {Escherichia coli [TaxId: 536056]}
pvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr

SCOPe Domain Coordinates for d4rzsa1:

Click to download the PDB-style file with coordinates for d4rzsa1.
(The format of our PDB-style files is described here.)

Timeline for d4rzsa1: