Lineage for d4rxja_ (4rxj A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2378441Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2378544Family b.34.9.2: PWWP domain [69250] (6 protein domains)
    includes the C-terminal all-alpha subdomain
  6. 2378564Protein automated matches [190966] (1 species)
    not a true protein
  7. 2378565Species Human (Homo sapiens) [TaxId:9606] [188600] (8 PDB entries)
  8. 2378573Domain d4rxja_: 4rxj A: [309605]
    automated match to d2daqa1
    complexed with unx

Details for d4rxja_

PDB Entry: 4rxj (more details), 2.1 Å

PDB Description: crystal structure of whsc1l1-pwwp2
PDB Compounds: (A:) Histone-lysine N-methyltransferase NSD3

SCOPe Domain Sequences for d4rxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rxja_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klhykqivwvklgnyrwwpaeicnprsvplniqglkhdlgdfpvfffgshdyywvhqgrv
fpyvegdksfaegqtsinktfkkaleeaakrfqelkaqreskealeie

SCOPe Domain Coordinates for d4rxja_:

Click to download the PDB-style file with coordinates for d4rxja_.
(The format of our PDB-style files is described here.)

Timeline for d4rxja_: