| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
| Protein automated matches [190890] (7 species) not a true protein |
| Species Sedum alfredii [TaxId:439688] [311437] (1 PDB entry) |
| Domain d4rvpd_: 4rvp D: [309602] automated match to d3mnda_ complexed with zn |
PDB Entry: 4rvp (more details), 2.6 Å
SCOPe Domain Sequences for d4rvpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvpd_ b.1.8.0 (D:) automated matches {Sedum alfredii [TaxId: 439688]}
milaakkkavavlkgnsavegvvtltqeedgpttvnvritgltpgphgfhlhefgdttng
cistgphfnpkglthgapedeirhagdlgnivanadgvaevtivdnqipltgpnavvgra
fvvheleddlgkgghelslstgnaggrlacgvigltpt
Timeline for d4rvpd_: